PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30074.m001347
Common NameRCOM_1329560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Whirly
Protein Properties Length: 173aa    MW: 19235.4 Da    PI: 9.9801
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30074.m001347genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly120.79.6e-387617120115
         Whirly  20 aldsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnsl 115
                    +++sg+lk++r+G +ll++ +a++erkyd+ek+qsfals+tev++l++l++k+s + fhdp++ +sn+G+vrk+l+++P+++G G+f++ls  n++
  30074.m001347  76 TVQSGHLKVERRGVILLTFLPAIGERKYDYEKRQSFALSTTEVGSLISLGPKDSFDCFHDPGMLSSNAGEVRKSLSLKPHAEGGGYFISLSSWNNV 171
                    678***************************************************************************************987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF544473.61E-2976171IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.104.4E-3676172IPR009044ssDNA-binding transcriptional regulator
PfamPF085365.6E-3676171IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MMKLSRLLQQ SRNSLGKSID ARDASALHDL TFRAGISTFR QDFTIKGSLS NEYMLLIPFT  60
REKXXGSNNV SLHSHTVQSG HLKVERRGVI LLTFLPAIGE RKYDYEKRQS FALSTTEVGS  120
LISLGPKDSF DCFHDPGMLS SNAGEVRKSL SLKPHAEGGG YFISLSSWNN VNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_D6e-437717136130Single-stranded DNA-binding protein WHY2, mit
4kop_C6e-437717136130Single-stranded DNA-binding protein WHY2, mit
4kop_B6e-437717136130Single-stranded DNA-binding protein WHY2, mit
4kop_A6e-437717136130Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576392.12e-94PREDICTED: LOW QUALITY PROTEIN: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotD9J0346e-46WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLB9S6Y61e-124B9S6Y6_RICCO; Putative uncharacterized protein
STRINGPOPTR_0003s04700.15e-58(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF113833338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.12e-44WHIRLY 2